| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM84950 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 10±n/a nM |
|---|
| Comments | PDSP_1623 |
|---|
| Citation |  Eglen, RM; Bonhaus, DW; Johnson, LG; Leung, E; Clark, RD Pharmacological characterization of two novel and potent 5-HT4 receptor agonists, RS 67333 and RS 67506, in vitro and in vivo. Br J Pharmacol115:1387-92 (1995) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM84950 |
|---|
| n/a |
|---|
| Name | BDBM84950 |
|---|
| Synonyms: | CAS_183782 | NSC_183782 | RS 67333 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H29ClN2O2 |
|---|
| Mol. Mass. | 352.899 |
|---|
| SMILES | CCCCN1CCC(CCC(=O)c2cc(Cl)c(N)cc2OC)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
