Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1d (5-HT1d) receptor
LigandBDBM50060417
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_1663
Citation Kennett GAWood MDBright FCilia JPiper DCGager TThomas DBaxter GSForbes ITHam PBlackburn TP In vitro and in vivo profile of SB 206553, a potent 5-HT2C/5-HT2B receptor antagonist with anxiolytic-like properties. Br J Pharmacol 117:427-434 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
Serotonin 1d (5-HT1d) receptor
Name:Serotonin 1d (5-HT1d) receptor
Synonyms:5-HT1D | 5-hydroxytryptamine receptor 1D | HTR1D
Type:Enzyme Catalytic Domain
Mol. Mass.:41780.38
Organism:GUINEA PIG
Description:5-HT1D HTR1D GUINEA PIG::Q60484
Residue:376
Sequence:
MSPPNQSEEGLPQEASNRSLNATETPGDWDPGLLQALKVSLVVVLSIITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAGAMIAAVWVISICISIPPLFWRQAQ
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYSRIYRAARSRILNPPSLSGKRFT
TAHLITGSAGSSLCSLNPSLHEGHMHPGSPLFFNHVRIKLADSVLERKRISAARERKATK
TLGIILGAFIVCWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNE
DFRQAFQKVVHFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060417
n/a
NameBDBM50060417
Synonyms:5-Methyl-3,5-dihydro-2H-pyrrolo[2,3-f]indole-1-carboxylic acid pyridin-3-ylamide | CHEMBL297784 | SB 206553 | SB-206553
TypeSmall organic molecule
Emp. Form.C17H16N4O
Mol. Mass.292.3351
SMILESCn1ccc2cc3N(CCc3cc12)C(=O)Nc1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: