Reaction Details |
| Report a problem with these data |
Target | Apamin |
---|
Ligand | BDBM50049750 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_218 |
---|
Citation | Sullivan, JP; Donnelly-Roberts, D; Briggs, CA; Anderson, DJ; Gopalakrishnan, M; Piattoni-Kaplan, M; Campbell, JE; McKenna, DG; Molinari, E; Hettinger, AM; Garvey, DS; Wasicak, JT; Holladay, MW; Williams, M; Arneric, SP A-85380 [3-(2(S)-azetidinylmethoxy) pyridine]: in vitro pharmacological properties of a novel, high affinity alpha 4 beta 2 nicotinic acetylcholine receptor ligand. Neuropharmacology35:725-34 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Apamin |
---|
Name: | Apamin |
Synonyms: | APAM_APIME | Apamine |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 5226.87 |
Organism: | Apis mellifera (Honeybee) |
Description: | Potassium channel, Apamin 0 0::P01500 |
Residue: | 46 |
Sequence: | MISMLRCIYLFLSVILITSYFVTPVMPCNCKAPETALCARRCQQHG
|
|
|
BDBM50049750 |
---|
n/a |
---|
Name | BDBM50049750 |
Synonyms: | (S)-3-(azetidin-2-ylmethoxy)pyridine | 3-((S)-1-Azetidin-2-ylmethoxy)-pyridine | A-159470 | A-85380 | CHEMBL59986 |
Type | Small organic molecule |
Emp. Form. | C9H12N2O |
Mol. Mass. | 164.2044 |
SMILES | C(Oc1cccnc1)[C@@H]1CCN1 |r| |
Structure |
|