Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP1 Receptor
LigandBDBM82094
Substrate/Competitorn/a
Ki 14±n/a nM
CommentsPDSP_1464
Citation Kiriyama MUshikubi FKobayashi THirata MSugimoto YNarumiya S Ligand binding specificities of the eight types and subtypes of the mouse prostanoid receptors expressed in Chinese hamster ovary cells. Br J Pharmacol 122:217-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
Prostanoid EP1 Receptor
Name:Prostanoid EP1 receptor
Synonyms:PGE receptor, EP1 subtype | Prostaglandin E1 | Prostaglandin E2 receptor EP1 subtype
Type:G-protein coupled receptor
Mol. Mass.:43000.62
Organism:Mus musculus (Mouse)
Description:n/a
Residue:405
Sequence:
MSPCGLNLSLADEAATCATPRLPNTSVVLPTGDNGTSPALPIFSMTLGAVSNVLALALLA
QVAGRMRRRRSAATFLLFVASLLAIDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMV
FFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALAVLAAMALAVALLPLVHVGR
YELQYPGTWCFISLGPRGGWRQALLAGLFAGLGLAALLAALVCNTLSGLALLRARWRRRR
SRRFRKTAGPDDRRRWGSRGPRLASASSASSITSATATLRSSRGGGSARRVHAHDVEMVG
QLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAVRLASWNQILDPWVYILLRQA
MLRQLLRLLPLRVSAKGGPTELGLTKSAWEASSLRSSRHSGFSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82094
n/a
NameBDBM82094
Synonyms:17-PHENYL TRINOR PROSTAGLANDIN E2 | CAS_38315-43-4 | PGE2,17-Phenyl
TypeSmall organic molecule
Emp. Form.C23H30O5
Mol. Mass.386.4813
SMILESO[C@@H](CCc1ccccc1)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: