Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP2 Receptor
LigandBDBM85185
Substrate/Competitorn/a
Ki 17±n/a nM
CommentsPDSP_1463
Citation Kiriyama MUshikubi FKobayashi THirata MSugimoto YNarumiya S Ligand binding specificities of the eight types and subtypes of the mouse prostanoid receptors expressed in Chinese hamster ovary cells. Br J Pharmacol 122:217-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
Prostanoid EP2 Receptor
Name:Prostanoid EP2 receptor
Synonyms:PGE receptor, EP2 subtype | Prostaglandin E2 | Prostaglandin E2 receptor EP2 subtype
Type:G-protein coupled receptor
Mol. Mass.:40495.26
Organism:Mus musculus (Mouse)
Description:n/a
Residue:362
Sequence:
MDNFLNDSKLMEDCKSRQWLLSGESPAISSVMFSAGVLGNLIALALLARRWRGDTGCSAG
SRTSISLFHVLVTELVLTDLLGTCLISPVVLASYSRNQTLVALAPESHACTYFAFTMTFF
SLATMLMLFAMALERYLSIGYPYFYRRHLSRRGGLAVLPVIYGASLLFCSLPLLNYGEYV
QYCPGTWCFIRHGRTAYLQLYATMLLLLIVAVLACNISVILNLIRMHRRSRRSRCGLSGS
SLRGPGSRRRGERTSMAEETDHLILLAIMTITFAICSLPFTIFAYMDETSSLKEKWDLRA
LRFLSVNSIIDPWVFAILRPPVLRLMRSVLCCRTSLRTQEAQQTSCSTQSSASKQTDLCG
QL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85185
n/a
NameBDBM85185
Synonyms:PGE2,16,16-DIMETHYL
TypeSmall organic molecule
Emp. Form.C22H36O5
Mol. Mass.380.5182
SMILESCCCCC(C)(C)C(O)C=CC1C(O)CC(=O)C1CC=CCCCC(O)=O |w:9.8,19.19|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: