Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP3 Receptor
LigandBDBM81948
Substrate/Competitorn/a
Ki 23±n/a nM
CommentsPDSP_1772
Citation Kiriyama MUshikubi FKobayashi THirata MSugimoto YNarumiya S Ligand binding specificities of the eight types and subtypes of the mouse prostanoid receptors expressed in Chinese hamster ovary cells. Br J Pharmacol 122:217-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
Prostanoid EP3 Receptor
Name:Prostanoid EP3 receptor
Synonyms:PGE receptor, EP3 isoform alpha | PTGER3 | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3
Type:G-protein coupled receptor
Mol. Mass.:40092.50
Organism:Mus musculus (Mouse)
Description:n/a
Residue:365
Sequence:
MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81948
n/a
NameBDBM81948
Synonyms:CAS_89617-02-7 | ONO 11,113 | ONO-11113 | STA2
TypeSmall organic molecule
Emp. Form.C21H34O3S
Mol. Mass.366.558
SMILESCCCCC[C@H](O)\C=C\C1C[C@H]2C[C@H](S2)[C@@H]1C\C=C/CCCC(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: