Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTGIR
LigandBDBM23954
Substrate/Competitorn/a
Ki 11±n/a nM
CommentsPDSP_965
Citation Kiriyama MUshikubi FKobayashi THirata MSugimoto YNarumiya S Ligand binding specificities of the eight types and subtypes of the mouse prostanoid receptors expressed in Chinese hamster ovary cells. Br J Pharmacol 122:217-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
PTGIR
Name:PTGIR
Synonyms:Prostacyclin receptor | Prostaglandin I | Prostaglandin I2
Type:Enzyme Catalytic Domain
Mol. Mass.:44475.65
Organism:MOUSE
Description:Prostaglandin I2 PTGIR MOUSE::P43252
Residue:415
Sequence:
MMASDGHPGPPSVTPGSPLSAGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGNG
LALGILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTMLC
DTFAFAMTFFGLASTLILFAMAVERCLALSHPYLYAQLDGPRCARFALPSIYAFCCLFCS
LPLLGLGEHQQYCPGSWCFIRMRSAQPGGCAFSLAYASLMALLVTSIFFCNGSVTLSLYH
MYRQQRRHHGSFVPTSRAREDEVYHLILLALMTVIMAVCSLPLMIRGFTQAIAPDSREMG
DLLAFRFNAFNPILDPWVFILFRKAVFQRLKFWLCCLCARSVHGDLQAPLSRPASGRRDP
PAPTSLQAKEGSWVPLSSWGTGQVAPLTAVPLTGGDGCSVGMPSKSEAIAACSLC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23954
n/a
NameBDBM23954
Synonyms:5-[(2E,3aS,4R,5R,6aS)-5-hydroxy-4-[(1E,3S)-3-hydroxy-4-methyloct-1-en-6-yn-1-yl]-octahydropentalen-2-ylidene]pentanoic acid | CHEMBL494 | ILOPROST | Ventavis | [3H]-Iloprost
Typeradiolabeled ligand
Emp. Form.C22H32O4
Mol. Mass.360.4871
SMILES[H][C@]12C[C@@H](O)[C@H](\C=C\[C@@H](O)C(C)CC#CC)[C@@]1([H])C\C(C2)=C\CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: