Reaction Details |
| Report a problem with these data |
Target | Calcium-activated potassium channel subunit beta-1 |
---|
Ligand | BDBM21280 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_1751 |
---|
Citation | Rinaldi-Carmona, M; Barth, F; Millan, J; Derocq, JM; Casellas, P; Congy, C; Oustric, D; Sarran, M; Bouaboula, M; Calandra, B; Portier, M; Shire, D; Brelière, JC; Le Fur, GL SR 144528, the first potent and selective antagonist of the CB2 cannabinoid receptor. J Pharmacol Exp Ther284:644-50 (1998) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Calcium-activated potassium channel subunit beta-1 |
---|
Name: | Calcium-activated potassium channel subunit beta-1 |
Synonyms: | Calcium-activated potassium channel subunit beta-1 | KCMB1_HUMAN | KCNMB1 | Potassium Channel (Ca2+ dependent) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 21805.22 |
Organism: | Homo sapiens (Human) |
Description: | Potassium Channel (Ca2+ dependent) 0 HUMAN::Q16558 |
Residue: | 191 |
Sequence: | MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNI
RDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADV
EKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKS
NQYLSILAAQK
|
|
|
BDBM21280 |
---|
n/a |
---|
Name | BDBM21280 |
Synonyms: | 5-(4-chloro-3-methylphenyl)-1-[(4-methylphenyl)methyl]-N-[(1S)-1,3,3-trimethylbicyclo[2.2.1]heptan-2-yl]-1H-pyrazole-3-carboxamide | N-(1,3,3-trimethylbicyclo(2.2.1)heptan-2-yl)-5-(4-chloro-3-methylphenyl)-1-(4-methylbenzyl)pyrazole-3-carboxamide | SR 144528 | SR-144528 | SR144528 |
Type | Small organic molecule |
Emp. Form. | C29H34ClN3O |
Mol. Mass. | 476.053 |
SMILES | Cc1ccc(Cn2nc(cc2-c2ccc(Cl)c(C)c2)C(=O)NC2[C@@]3(C)CCC(C3)C2(C)C)cc1 |r,TLB:21:22:28:26.25| |
Structure |
|