Reaction Details |
| Report a problem with these data |
Target | Hematopoietic prostaglandin D synthase |
---|
Ligand | BDBM50109546 |
---|
Substrate/Competitor | n/a |
---|
Ki | 132±n/a nM |
---|
Comments | PDSP_468 |
---|
Citation | Abramovitz, M; Adam, M; Boie, Y; Carrière, M; Denis, D; Godbout, C; Lamontagne, S; Rochette, C; Sawyer, N; Tremblay, NM; Belley, M; Gallant, M; Dufresne, C; Gareau, Y; Ruel, R; Juteau, H; Labelle, M; Ouimet, N; Metters, KM The utilization of recombinant prostanoid receptors to determine the affinities and selectivities of prostaglandins and related analogs. Biochim Biophys Acta1483:285-93 (2000) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Hematopoietic prostaglandin D synthase |
---|
Name: | Hematopoietic prostaglandin D synthase |
Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
Type: | Enzyme |
Mol. Mass.: | 23341.07 |
Organism: | Homo sapiens (Human) |
Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
Residue: | 199 |
Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
BDBM50109546 |
---|
n/a |
---|
Name | BDBM50109546 |
Synonyms: | 5-[(3aS,4R,5R,6aS)-5-Hydroxy-4-((S)-3-hydroxy-oct-1-enyl)-hexahydro-pentalen-(2Z)-ylidene]-pentanoic acid | 5-[5-Hydroxy-4-(3-hydroxy-oct-1-enyl)-hexahydro-pentalen-2-ylidene]-pentanoic acidCarbacyclin | CARBACYCLIN | CHEMBL148319 | PGI2 |
Type | Small organic molecule |
Emp. Form. | C21H34O4 |
Mol. Mass. | 350.4923 |
SMILES | CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)C[C@@H]2C\C(C[C@H]12)=C\CCCC(O)=O |
Structure |
|