Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin D Synthase
LigandBDBM50240648
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_4303
Citation Abramovitz MAdam MBoie YCarrière MDenis DGodbout CLamontagne SRochette CSawyer NTremblay NMBelley MGallant MDufresne CGareau YRuel RJuteau HLabelle MOuimet NMetters KM The utilization of recombinant prostanoid receptors to determine the affinities and selectivities of prostaglandins and related analogs. Biochim Biophys Acta 1483:285-93 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
Prostaglandin D Synthase
Name:Prostaglandin D Synthase
Synonyms:Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | Prostaglandin D
Type:Enzyme
Mol. Mass.:23341.07
Organism:Homo sapiens (Human)
Description:The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag.
Residue:199
Sequence:
MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240648
n/a
NameBDBM50240648
Synonyms:LATANOPROST (FREE ACID) | PhXA 41 | Xalatan | isopropyl (5Z,9alpha,11alpha,15R)-9,11,15-trihydroxy-17-phenyl-18,19,20-trinorprost-5-en-1-oate | isopropyl (Z)-7-((1R,2R,3R,5S)-3,5-dihydroxy-2-((3R)-3-hydroxy-5-phenylpentyl)cyclopentyl)-5-heptenoate | latanoprost | propan-2-yl (5Z)-7-{(1R,2R,3R,5S)-3,5-dihydroxy-2-[(3R)-3-hydroxy-5-phenylpentyl]cyclopentyl}hept-5-enoate
TypeSmall organic molecule
Emp. Form.C26H40O5
Mol. Mass.432.5928
SMILESCC(C)OC(=O)CCC\C=C/C[C@H]1[C@@H](O)C[C@@H](O)[C@@H]1CC[C@@H](O)CCc1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: