| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hematopoietic prostaglandin D synthase |
|---|
| Ligand | BDBM82213 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1.7±n/a nM |
|---|
| Comments | PDSP_1458 |
|---|
| Citation |  Abramovitz, M; Adam, M; Boie, Y; Carrière, M; Denis, D; Godbout, C; Lamontagne, S; Rochette, C; Sawyer, N; Tremblay, NM; Belley, M; Gallant, M; Dufresne, C; Gareau, Y; Ruel, R; Juteau, H; Labelle, M; Ouimet, N; Metters, KM The utilization of recombinant prostanoid receptors to determine the affinities and selectivities of prostaglandins and related analogs. Biochim Biophys Acta1483:285-93 (2000) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Hematopoietic prostaglandin D synthase |
|---|
| Name: | Hematopoietic prostaglandin D synthase |
|---|
| Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23341.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
|---|
| Residue: | 199 |
|---|
| Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
|---|
| BDBM82213 |
|---|
| n/a |
|---|
| Name | BDBM82213 |
|---|
| Synonyms: | CAS_41598-07-6 | NSC_114678 | PGD2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H30O4 |
|---|
| Mol. Mass. | 334.4498 |
|---|
| SMILES | CCCCCC(O)CC=C1C(CC=CCCCC(O)=O)C=CC1=O |w:8.7,12.11,c:20| |
|---|
| Structure | 
|
|---|
Search and Browse
