Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin F2-alpha receptor
LigandBDBM50085910
Substrate/Competitorn/a
Ki 0.47±n/a nM
CommentsPDSP_547
Citation Abramovitz MAdam MBoie YCarrière MDenis DGodbout CLamontagne SRochette CSawyer NTremblay NMBelley MGallant MDufresne CGareau YRuel RJuteau HLabelle MOuimet NMetters KM The utilization of recombinant prostanoid receptors to determine the affinities and selectivities of prostaglandins and related analogs. Biochim Biophys Acta 1483:285-93 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
Prostaglandin F2-alpha receptor
Name:Prostaglandin F2-alpha receptor
Synonyms:PGF receptor | PGF2 alpha receptor | PGF2-alpha receptor | PTGFR | Prostaglandin F | Prostanoid FP receptor
Type:Enzyme
Mol. Mass.:40072.29
Organism:Homo sapiens (Human)
Description:P43088
Residue:359
Sequence:
MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQ
KSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGL
CPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQ
ASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQG
RSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD
PWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085910
n/a
NameBDBM50085910
Synonyms:(Z)-7-{(1R,2R,3R,5S)-2-[(E)-(R)-4-(3-Chloro-phenoxy)-3-hydroxy-but-1-enyl]-3,5-dihydroxy-cyclopentyl}-hept-5-enoic acid | 7-{2-[4-(3-Chloro-phenoxy)-3-hydroxy-but-1-enyl]-3,5-dihydroxy-cyclopentyl}-hept-5-enoic acid | CHEMBL37853 | CLOPROSTENOL
TypeSmall organic molecule
Emp. Form.C22H29ClO6
Mol. Mass.424.915
SMILESO[C@@H](COc1cccc(Cl)c1)\C=C\[C@H]1[C@H](O)C[C@H](O)[C@@H]1C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: