Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targethistone lysine demethylase PHF8 isoform 2
LigandBDBM276086
Substrate/Competitorn/a
Meas. Tech.PHF8 Assay
Temperature298.15±n/a K
IC50 5500±n/a nM
Commentsextracted
Citation Chen YKNie ZStafford JAVeal JM Histone demethylase inhibitors US Patent  US10071984 Publication Date 9/11/2018
More Info.:Get all data from this article,  Assay Method
 
histone lysine demethylase PHF8 isoform 2
Name:histone lysine demethylase PHF8 isoform 2
Synonyms:NP_055922 | PHF8
Type:Enzyme Catalytic Domain
Mol. Mass.:113932.27
Organism:Homo sapiens (Human)
Description:n/a
Residue:1024
Sequence:
MASVPVYCLCRLPYDVTRFMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPS
IMKKRRGSSKGHDTHKGKPVKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENS
FSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYY
SGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVR
DSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKC
YKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFR
FPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEI
PETVRTVQLIKDLAREIRLVEDIFQQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMS
RLSLPSKNGSKKKGLKPKELFKKAERKGKESSALGPAGQLSYNLMDTYSHQALKTGSFQK
AKFNITGACLNDSDDDSPDLDLDGNESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKAR
LMAEQVMEDEFDLDSDDELQIDERLGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEV
EFDIEEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQE
AIQGMLCMANLQSSSSSPATSSLQAWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPI
KRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDD
APWSPKARVTPTLPKQDRPVREGTRVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLL
KEVEQPRPQDSNLSLTVPAPTVAATPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNA
FGMAQANRSTTPMAPGVFLTQRRPSVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNG
KLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM276086
n/a
NameBDBM276086
Synonyms:1-[(3,4-dichlorophenyl)methyl]-4-{1H-[1,2,3]triazolo[4,5-c]pyridin-6-yl}-1H-imidazole | US10071984, Example 48 | US10174003, Example 48
TypeSmall organic molecule
Emp. Form.C15H10Cl2N6
Mol. Mass.345.186
SMILESClc1ccc(Cn2cnc(c2)-c2cc3[nH]nnc3cn2)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: