Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMotilin
LigandBDBM85615
Substrate/Competitorn/a
Ki 3.4±n/a nM
CommentsPDSP_6649
Citation Tsukamoto KKuboyama NYamano MNakazawa TSuzuki T In vitro pharmacological profile of SK-896, a new human motilin analogue. Pharmacology 60:128-35 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
Motilin
Name:Motilin
Synonyms:Promotilin
Type:Enzyme Catalytic Domain
Mol. Mass.:14668.99
Organism:RABBIT
Description:Motilin 0 RABBIT::P27114
Residue:133
Sequence:
MVSRKAVAALLLVHVTAMLASQTEAFVPIFTYSELQRMQERERNRGHKKSLSVQQRSDAA
AAPRPAEPTLEEENGRMQLTAPVEIGMRMNSRQLEKYRAALEAAERAVHPDAPSRPCWPA
GGESGWSGEPSPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85615
n/a
NameBDBM85615
Synonyms:L-Phe-L-Val-L-Pro-L-Ile-L-Phe-L-Thr-L-Tyr-Gly-L-Glu-L-Leu-L-Gln-L-Arg-L-Leu-L-Gln-L-Glu-L-Lys-L-Glu-L-Arg-L-Asn-L-Lys-Gly-L-Gln-L-Hse-OH | SK-896
TypeSmall organic molecule
Emp. Form.C125H197N35O37
Mol. Mass.2782.114
SMILES[#6]-[#6]-[#6@H](-[#6])-[#6@H](-[#7]-[#6](=O)-[#6@@H]-1-[#6]-[#6]-[#6]-[#7]-1-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@@H](-[#7])-[#6]-c1ccccc1)-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccccc1)-[#6](=O)-[#7]-[#6@@H](-[#6@@H](-[#6])-[#8])-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccc(-[#8])cc1)-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6](-[#8])=O)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6](-[#7])=O)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6](-[#7])=O)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6](-[#8])=O)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6](-[#8])=O)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6](-[#7])=O)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6](-[#7])=O)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#8])-[#6](-[#8])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: