Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1D |
---|
Ligand | BDBM50028421 |
---|
Substrate/Competitor | n/a |
---|
Ki | 13.18±n/a nM |
---|
Comments | PDSP_1453 |
---|
Citation | Millan, MJ; Maiofiss, L; Cussac, D; Audinot, V; Boutin, JA; Newman-Tancredi, A Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther303:791-804 (2002) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
5-hydroxytryptamine receptor 1D |
---|
Name: | 5-hydroxytryptamine receptor 1D |
Synonyms: | 5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | 5HT1D_HUMAN | HTR1D | HTR1DA | HTRL | Serotonin (5-HT) receptor | Serotonin Receptor 1D |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41920.63 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells. |
Residue: | 377 |
Sequence: | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
|
|
|
BDBM50028421 |
---|
n/a |
---|
Name | BDBM50028421 |
Synonyms: | 9-Methylsulfanylmethyl-7-propyl-4,6,6a,7,8,9,10,10a-octahydro-indolo[4,3-fg]quinoline; compound with methanesulfonic acid | CHEMBL1275 | LY-127809 | PERGOLIDE MESYLATE | Pergolide | Permax |
Type | Small organic molecule |
Emp. Form. | C19H26N2S |
Mol. Mass. | 314.488 |
SMILES | CCCN1C[C@H](CSC)C[C@H]2[C@H]1Cc1c[nH]c3cccc2c13 |
Structure |
|