| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Type-1 angiotensin II receptor B |
|---|
| Ligand | BDBM50287290 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.67±n/a nM |
|---|
| Comments | PDSP_3385 |
|---|
| Citation |  Inada, Y; Nakane, T; Chiba, S Binding of KRH-594, an antagonist of the angiotensin II type 1 receptor, to cloned human and rat angiotensin II receptors. Fundam Clin Pharmacol16:317-23 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Type-1 angiotensin II receptor B |
|---|
| Name: | Type-1 angiotensin II receptor B |
|---|
| Synonyms: | AGTRB_RAT | AT3 | Agtr1 | Agtr1b | Angiotensin II AT1B | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | At1b | Type-1B angiotensin II receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 40929.44 |
|---|
| Organism: | RAT |
|---|
| Description: | Angiotensin II AT1B 0 RAT::P29089 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
|
|
|
|---|
| BDBM50287290 |
|---|
| n/a |
|---|
| Name | BDBM50287290 |
|---|
| Synonyms: | CHEMBL34866 | KRH-594 | Potassium; 2-[5-ethyl-3-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-3H-[1,3,4]thiadiazol-(2Z)-ylidenecarbamoyl]-cyclopent-1-enecarboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H22N7O3S |
|---|
| Mol. Mass. | 500.553 |
|---|
| SMILES | CCc1nn(Cc2ccc(cc2)-c2ccccc2-c2nnn[nH]2)c(=NC(=O)C2=C(CCC2)C([O-])=O)s1 |w:24.27,t:30| |
|---|
| Structure | 
|
|---|
Search and Browse
