| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Ligand | BDBM86196 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_2978 |
|---|
| Citation |  Shi, Q; Savage, JE; Hufeisen, SJ; Rauser, L; Grajkowska, E; Ernsberger, P; Wroblewski, JT; Nadeau, JH; Roth, BL L-homocysteine sulfinic acid and other acidic homocysteine derivatives are potent and selective metabotropic glutamate receptor agonists. J Pharmacol Exp Ther305:131-42 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Name: | Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Synonyms: | Benzodiazepine central | Benzodiazepine receptors | GABA A Benzodiazepine | GABA A Benzodiazepine Type I | GABA A Benzodiazepine Type II | GABA A Benzodiazepine Type IIL | GABA A Benzodiazepine Type IIM | GABA A Benzodiazepine omega1 | GABA A Benzodiazepine omega2 | GABA A Benzodiazepine omega5 | GABA A alpha1 | GABA A anti-Alpha1 | GABA receptor alpha-1 subunit | GABA, Chloride, TBOB | GABA-PICROTOXIN | GBRA1_RAT | Gabra-1 | Gabra1 | TBPS |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 51770.21 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | P62813 |
|---|
| Residue: | 455 |
|---|
| Sequence: | MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
|
|
|
|---|
| BDBM86196 |
|---|
| n/a |
|---|
| Name | BDBM86196 |
|---|
| Synonyms: | D-homocysteic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C4H9NO5S |
|---|
| Mol. Mass. | 183.183 |
|---|
| SMILES | N[C@H](CCS(O)(=O)=O)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
