| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet-activating factor receptor |
|---|
| Ligand | BDBM86693 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_4862 |
|---|
| Citation |  Mimura, H; Ikemura, T; Kotera, O; Sawada, M; Tashiro, S; Fuse, E; Ueno, K; Manabe, H; Ohshima, E; Karasawa, A; Miyaji, H Inhibitory effect of the 4-aminotetrahydroquinoline derivatives, selective chemoattractant receptor-homologous molecule expressed on T helper 2 cell antagonists, on eosinophil migration induced by prostaglandin D2. J Pharmacol Exp Ther314:244-51 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Platelet-activating factor receptor |
|---|
| Name: | Platelet-activating factor receptor |
|---|
| Synonyms: | PAF Platelet activating factor | PAF-R | PAFR | PTAFR | PTAFR_HUMAN | Platelet activating factor receptor | Platelet-activating factor receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39219.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | PAF Platelet activating factor PTAFR HUMAN::P25105 |
|---|
| Residue: | 342 |
|---|
| Sequence: | MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
|
|
|
|---|
| BDBM86693 |
|---|
| n/a |
|---|
| Name | BDBM86693 |
|---|
| Synonyms: | K376 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24N2O2 |
|---|
| Mol. Mass. | 336.4275 |
|---|
| SMILES | CCC(=O)N1C(C)CC(N(C(C)=O)c2ccccc2)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
