| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Ligand | BDBM50173546 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| pH | 8±0 |
|---|
| Temperature | 298.15±0 K |
|---|
| Ki | 1.56e+5±n/a nM |
|---|
| Citation |  Musso-Buendía, JA; Vidal, AE; Kasinthan, G; Nguyen, C; Carrero-Lérida, J; Ruiz-Pérez, LM; Wilson, K; Johansson, NG; Gilbert, IH; González-Pacanowska, D Kinetic properties and inhibition of the dimeric dUTPase-dUDPase from Campylobacter jejuni. J Enzyme Inhib Med Chem24:111-6 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Name: | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Synonyms: | DUT | DUT_HUMAN | Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) | Deoxyuridine triphosphatase (dUTPase) | dUTP pyrophosphatase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26574.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33316 |
|---|
| Residue: | 252 |
|---|
| Sequence: | MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
|
|
|
|---|
| BDBM50173546 |
|---|
| n/a |
|---|
| Name | BDBM50173546 |
|---|
| Synonyms: | 1-(5-Trityloxymethyl-2,5-dihydro-furan-2-yl)-1H-pyrimidine-2,4-dione | CHEMBL369937 | dUTPase inhibitor, 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H24N2O4 |
|---|
| Mol. Mass. | 452.5012 |
|---|
| SMILES | O=c1ccn(C2OC(COC(c3ccccc3)(c3ccccc3)c3ccccc3)C=C2)c(=O)[nH]1 |c:32| |
|---|
| Structure | 
|
|---|
Search and Browse
