Reaction Details |
| Report a problem with these data |
Target | dCTP deaminase |
---|
Ligand | BDBM50173530 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
pH | 8±0 |
---|
Temperature | 298.15±0 K |
---|
Ki | 1.000000e+9±n/a nM |
---|
Citation | Musso-Buendía, JA; Vidal, AE; Kasinthan, G; Nguyen, C; Carrero-Lérida, J; Ruiz-Pérez, LM; Wilson, K; Johansson, NG; Gilbert, IH; González-Pacanowska, D Kinetic properties and inhibition of the dimeric dUTPase-dUDPase from Campylobacter jejuni. J Enzyme Inhib Med Chem24:111-6 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
dCTP deaminase |
---|
Name: | dCTP deaminase |
Synonyms: | DCD_CAMJE | Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) | dcd |
Type: | Protein |
Mol. Mass.: | 20698.65 |
Organism: | Campylobacter jejuni |
Description: | n/a |
Residue: | 186 |
Sequence: | MGLKADNWIRKMALEHKMIEPFCEANIGKGVVSYGLSSYGYDIRVGREFKIFTNVNSTVV
DPKNFVEENVVDFEGDVCIVPANSFALARTIEYFKMPDNVLAICLGKSTYARCGIIVNVT
PFEPGFEGHITIEISNTTPLPAKIYANEGIAQVLFLQGDEKCDTTYKDKKGKYQAQTGIT
LPRILK
|
|
|
BDBM50173530 |
---|
n/a |
---|
Name | BDBM50173530 |
Synonyms: | 1-[5-(tert-Butyl-diphenyl-silanyloxymethyl)-4-hydroxy-tetrahydro-furan-2-yl]-1H-pyrimidine-2,4-dione | CHEMBL370768 | dUTPase inhibitor, 9 |
Type | Small organic molecule |
Emp. Form. | C25H30N2O5Si |
Mol. Mass. | 466.6016 |
SMILES | CC(C)(C)[Si](OCC1OC(CC1O)n1ccc(=O)[nH]c1=O)(c1ccccc1)c1ccccc1 |
Structure |
|