Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrokinase-type plasminogen activator
LigandBDBM50138663
Substrate/Competitorn/a
Meas. Tech.Abbott uPA__Urokinase Human - Ki(uM)
pH7.4±n/a
Temperature298.15±n/a K
Ki 5910±n/a nM
Citation CSARdock CD UROKINASE in CSAR_FULL_RELEASE_3JULY2012 CSAR 1:0 (2012) [PubMed]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Urokinase-type plasminogen activator
Name:Urokinase-type plasminogen activator/surface receptor
Synonyms:U-plasminogen activator | Urokinase | Urokinase-type plasminogen activator (uPA)
Type:Enzyme
Mol. Mass.:48528.62
Organism:Homo sapiens (Human)
Description:P00749
Residue:431
Sequence:
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138663
n/a
NameBDBM50138663
Synonyms:2-naphthimidamide | CHEMBL105171 | Naphthalene-2-carboxamidine | uPa_6
TypeSmall organic molecule
Emp. Form.C11H10N2
Mol. Mass.170.2105
SMILESNC(=N)c1ccc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: