| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity mitogen-activated protein kinase kinase 6 |
|---|
| Ligand | BDBM29678 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarization (FP) Assay |
|---|
| IC50 | >2.50e+5±n/a nM |
|---|
| Citation |  Bannwarth, L; Goldberg, AB; Chen, C; Turk, BE Identification of exosite-targeting inhibitors of anthrax lethal factor by high-throughput screening. Chem Biol19:875-82 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity mitogen-activated protein kinase kinase 6 |
|---|
| Name: | Dual specificity mitogen-activated protein kinase kinase 6 |
|---|
| Synonyms: | Dual specificity mitogen-activated protein kinase kinase 6 | MAP kinase kinase 6 | MAP2K6 | MAPK/ERK kinase 6 | MAPKK 6 | MEK6 | MKK6 | MP2K6_HUMAN | Mitogen-activated protein kinase kinase 6 (MKK6) | PRKMK6 | SAPKK3 | SKK3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 37494.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P52564 |
|---|
| Residue: | 334 |
|---|
| Sequence: | MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
|
|
|
|---|
| BDBM29678 |
|---|
| n/a |
|---|
| Name | BDBM29678 |
|---|
| Synonyms: | Reduced parellic acid, 9 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16O8 |
|---|
| Mol. Mass. | 360.3148 |
|---|
| SMILES | COc1cc(C(O)=O)c2Oc3c(CO)c(O)cc(C)c3C(=O)Oc2c1C |
|---|
| Structure | 
|
|---|
Search and Browse
