Reaction Details |
| Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM31712 |
---|
Substrate/Competitor | BDBM92519 |
---|
Meas. Tech. | Tautomerase Enzyme Assay |
---|
pH | 6.5±0 |
---|
Ki | 5.55e+3±n/a nM |
---|
IC50 | 6.00e+3±n/a nM |
---|
Citation | Ouertatani-Sakouhi, H; El-Turk, F; Fauvet, B; Cho, MK; Pinar Karpinar, D; Le Roy, D; Dewor, M; Roger, T; Bernhagen, J; Calandra, T; Zweckstetter, M; Lashuel, HA Identification and characterization of novel classes of macrophage migration inhibitory factor (MIF) inhibitors with distinct mechanisms of action. J Biol Chem285:26581-98 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM31712 |
---|
BDBM92519 |
---|
Name | BDBM31712 |
Synonyms: | HEXACHLOROPHENE | Hexach-lorophene | MLS000028433 | SMR000058356 | cid_3598 |
Type | Small organic molecule |
Emp. Form. | C13H6Cl6O2 |
Mol. Mass. | 406.904 |
SMILES | Oc1c(Cl)cc(Cl)c(Cl)c1Cc1c(O)c(Cl)cc(Cl)c1Cl |
Structure |
|