Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinesterases
LigandBDBM50100134
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 4.99e+3± 1.3e+2 nM
Citation Macdonald IRMartin ERosenberry TLDarvesh S Probing the peripheral site of human butyrylcholinesterase. Biochemistry 51:7046-53 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholinesterases
Name:Cholinesterases
Synonyms:AChE | Acetylcholinesterase (AChE) | Acetylcholinesterase (human AChE)
Type:Enzyme
Mol. Mass.:67792.70
Organism:Homo sapiens (Human)
Description:P22303
Residue:614
Sequence:
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50100134
n/a
NameBDBM50100134
Synonyms:2-(4-Dimethylamino-phenyl)-3,6-dimethyl-benzothiazol-3-ium | 2-(4-Dimethylamino-phenyl)-3,6-dimethyl-benzothiazol-3-ium(thioflavin T) | 2-[4-(dimethylamino)phenyl]-3,6-dimethyl-1,3-benzothiazol-3-ium | CHEMBL224392 | CHEMBL57267 | Thioflavin T | Thioflavin T, 1 | [4-(3,6-dimethyl-benzothiazol-2-yl)-phenyl]-dimethyl-amine | cid_16954
TypeSmall organic molecule
Emp. Form.C17H19N2S
Mol. Mass.283.411
SMILESCN(C)c1ccc(cc1)-c1sc2cc(C)ccc2[n+]1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: