| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbon monoxide dehydrogenase small chain |
|---|
| Ligand | BDBM22774 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| Kd | 4.76e+4±n/a nM |
|---|
| Citation |  Wilcoxen, J; Zhang, B; Hille, R Reaction of the molybdenum- and copper-containing carbon monoxide dehydrogenase from Oligotropha carboxydovorans with quinones. Biochemistry50:1910-6 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbon monoxide dehydrogenase small chain |
|---|
| Name: | Carbon monoxide dehydrogenase small chain |
|---|
| Synonyms: | Carbon monoxide dehydrogenase (CODH) | DCMS_AFIC5 | coxS |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17790.76 |
|---|
| Organism: | Oligotropha carboxidovorans |
|---|
| Description: | P19921 |
|---|
| Residue: | 166 |
|---|
| Sequence: | MAKAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVK
SCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQEN
PSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEEAAE
|
|
|
|---|
| BDBM22774 |
|---|
| n/a |
|---|
| Name | BDBM22774 |
|---|
| Synonyms: | 1,4-Benzoquinone | Benzil-related compound, 53 | CHEMBL8320 | benzoquinone | cid_4650 | cyclohexa-2,5-diene-1,4-dione |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C6H4O2 |
|---|
| Mol. Mass. | 108.0948 |
|---|
| SMILES | O=C1C=CC(=O)C=C1 |c:2,6| |
|---|
| Structure | 
|
|---|
Search and Browse
