| Reaction Details |
|---|
 | Report a problem with these data |
| Target | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Ligand | BDBM92900 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| Km | 90000±10000 nM |
|---|
| Citation |  Wang, Y; Monzingo, AF; Hu, S; Schaller, TH; Robertus, JD; Fast, W Developing dual and specific inhibitors of dimethylarginine dimethylaminohydrolase-1 and nitric oxide synthase: toward a targeted polypharmacology to control nitric oxide. Biochemistry48:8624-35 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Name: | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Synonyms: | DDAH | DDAH1 | DDAH1_HUMAN | Dimethylarginine dimethylaminohydrolase (DDAH-1) | Dimethylarginine dimethylaminohydrolase 1 (DDAH) | Dimethylarginine dimethylaminohydrolase 1 (DDAH) E78A | Dimethylarginine dimethylaminohydrolase 1 (DDAH) L271G | Dimethylarginine dimethylaminohydrolase 1 (DDAH) L30A | Dimethylarginine dimethylaminohydrolase 1 (DDAH1) | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 31116.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O94760 |
|---|
| Residue: | 285 |
|---|
| Sequence: | MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGL
QVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
|
|
|
|---|
| BDBM92900 |
|---|
| n/a |
|---|
| Name | BDBM92900 |
|---|
| Synonyms: | CHEMBL1835117 | L-Arginine, 2 | NMMA, 2 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C7H16N4O2 |
|---|
| Mol. Mass. | 188.2275 |
|---|
| SMILES | CN=C(N)NCCC[C@H](N)C(O)=O |r,w:1.0| |
|---|
| Structure | 
|
|---|
Search and Browse
