| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
|---|
| Ligand | BDBM97442 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Thermal Shift Assay |
|---|
| pH | 7.5±0 |
|---|
| Ki | 1.01±0.19 nM |
|---|
| Citation |  Chang, A; Schiebel, J; Yu, W; Bommineni, GR; Pan, P; Baxter, MV; Khanna, A; Sotriffer, CA; Kisker, C; Tonge, PJ Rational Optimization of Drug-Target Residence Time: Insights from Inhibitor Binding to the Staphylococcus aureus FabI Enzyme-Product Complex. Biochemistry52:4217-28 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
|---|
| Synonyms: | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI | FABI_STAAR | NADPH-dependent enoyl-ACP reductase | fabI | trans-2-enoyl-[acyl carrier protein] reductase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27989.00 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | Q6GI75 |
|---|
| Residue: | 256 |
|---|
| Sequence: | MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
|
|
|
|---|
| BDBM97442 |
|---|
| n/a |
|---|
| Name | BDBM97442 |
|---|
| Synonyms: | PT446 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C13H8FNO2 |
|---|
| Mol. Mass. | 229.2065 |
|---|
| SMILES | Oc1cc(F)ccc1Oc1ccccc1C#N |
|---|
| Structure | 
|
|---|
Search and Browse
