Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
---|
Ligand | BDBM97445 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Thermal Shift Assay |
---|
pH | 7.5±0 |
---|
Ki | 0.01±0 nM |
---|
Citation | Chang, A; Schiebel, J; Yu, W; Bommineni, GR; Pan, P; Baxter, MV; Khanna, A; Sotriffer, CA; Kisker, C; Tonge, PJ Rational Optimization of Drug-Target Residence Time: Insights from Inhibitor Binding to the Staphylococcus aureus FabI Enzyme-Product Complex. Biochemistry52:4217-28 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
Synonyms: | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI | FABI_STAAR | NADPH-dependent enoyl-ACP reductase | fabI | trans-2-enoyl-[acyl carrier protein] reductase |
Type: | Enzyme |
Mol. Mass.: | 27989.00 |
Organism: | Staphylococcus aureus |
Description: | Q6GI75 |
Residue: | 256 |
Sequence: | MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
|
|
|
BDBM97445 |
---|
n/a |
---|
Name | BDBM97445 |
Synonyms: | PT119 |
Type | Small molecule |
Emp. Form. | C19H21NO2 |
Mol. Mass. | 295.3755 |
SMILES | CCCCCCc1ccc(Oc2ccccc2C#N)c(O)c1 |
Structure |
|