Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMacrophage colony-stimulating factor 1 (CSF-1)
LigandBDBM97730
Substrate/Competitorn/a
Meas. Tech.Fluorescence Polarization Competition Immunoassay
pH7.5±0
IC50 1e+1± 0 nM
Citation Illig CRBallentine SKChen JDesJarlais RLMeegalla SKWall MWilson K Inhibitors of c-fms kinase US Patent  US8481564 Publication Date 7/9/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Macrophage colony-stimulating factor 1 (CSF-1)
Name:Macrophage colony-stimulating factor 1 (CSF-1)
Synonyms:n/a
Type:Protein
Mol. Mass.:60631.84
Organism:Mus musculus (Mouse)
Description:P07141
Residue:552
Sequence:
MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQME
TSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLN
SCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSS
RDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELP
LRIEDPGSAKQRPPRSTCQTLESTEQPNHGDRLTEDSQPHPSAGGPVPGVEDILESSLGT
NWVLEEASGEASEGFLTQEAKFSPSTPVGGSIQAETDRPRALSASPFPKSTEDQKPVDIT
DRPLTEVNPMRPIGQTQNNTPEKTDGTSTLREDHQEPGSPHIATPNPQRVSNSATPVAQL
LLPKSHSWGIVLPLGELEGKRSTRDRRSPAELEGGSASEGAARPVARFNSIPLTDTGHVE
QHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKWKWRSHRDPQTLDSSVGRPEDSSL
TQDEDRQVELPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM97730
n/a
NameBDBM97730
Synonyms:US8481564, 6
TypeSmall organic molecule
Emp. Form.C21H24N6O4S
Mol. Mass.456.518
SMILESOCc1cc(NC(=O)c2nc(c[nH]2)C#N)c(cc1C1CNS(=O)(=O)NC1)C1=CCCCC1 |t:29|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: