Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM4136 |
---|
Substrate/Competitor | HIV Protease Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
IC50 | 0.5±n/a nM |
---|
Citation | Takashiro, E; Hayakawa, I; Nitta, T; Kasuya, A; Miyamoto, S; Ozawa, Y; Yagi, R; Yamamoto, I; Shibayama, T; Nakagawa, A; Yabe, Y Structure-activity relationship of HIV-1 protease inhibitors containing alpha-hydroxy-beta-amino acids. Detailed study of P1 site. Bioorg Med Chem7:2063-72 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM4136 |
---|
HIV Protease Peptide Substrate |
---|
Name: | HIV Protease Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 2686.50 |
Organism: | n/a |
Description: | n/a |
Residue: | 24 |
Sequence: | Ac-Ser-Gln-Asn-Tyr-Pro-Ile-Val-NH2
|
|
|