Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoglyceride Lipase (MGL)
LigandBDBM280586
Substrate/Competitorn/a
Meas. Tech.In Vitro Competitive Activity-Based Protein Profiling
IC50<100±n/a nM
Citation Cisar JSGrice CAJones TKWeber ODBuzard DJShaghafi MB Spirocycle compounds and methods of making and using same US Patent  US10030020 Publication Date 7/24/2018
More Info.:Get all data from this article,  Assay Method
 
Monoglyceride Lipase (MGL)
Name:Monoglyceride Lipase (MGL)
Synonyms:MAG lipase | Monoacylglycerol lipase
Type:Hydrolase
Mol. Mass.:33391.67
Organism:Mus musculus (mouse)
Description:Assays were using membranes of recombinant MAG Lipase transiently transfected in COS-7 cells.
Residue:303
Sequence:
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLG
HSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRID
SSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM280586
n/a
NameBDBM280586
Synonyms:US10030020, Example 131
TypeSmall organic molecule
Emp. Form.C23H28ClF6N3O3
Mol. Mass.543.93
SMILESFC(F)(F)C(OC(=O)N1CCC2(CCCN2Cc2ccc(Cl)c(c2)N2CCOCC2)CC1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: