| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Ligand | BDBM101907 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| IC50 | 1.1e+2±n/a nM |
|---|
| Citation |  Fukuoka, M; Yokogawa, T; Miyahara, S; Miyakoshi, H; Yano, W; Taguchi, J; Takao, Y Uracil compound or salt thereof having human deoxyuridine triphosphatase inhibitory activity US Patent US8530490 Publication Date 9/10/2013 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Name: | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Synonyms: | DUT | DUT_HUMAN | Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) | Deoxyuridine triphosphatase (dUTPase) | dUTP pyrophosphatase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26574.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33316 |
|---|
| Residue: | 252 |
|---|
| Sequence: | MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
|
|
|
|---|
| BDBM101907 |
|---|
| n/a |
|---|
| Name | BDBM101907 |
|---|
| Synonyms: | US8530490, 179 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H26N4O5S |
|---|
| Mol. Mass. | 470.541 |
|---|
| SMILES | CC(C)(NS(=O)(=O)c1cccc(OCC2CC2)c1)c1ccc(Cn2ccc(=O)[nH]c2=O)nc1 |
|---|
| Structure | 
|
|---|
Search and Browse
