Reaction Details |
| Report a problem with these data |
Target | Tumor necrosis factor |
---|
Ligand | BDBM102736 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
Ki | 0.18±0 nM |
---|
IC50 | 86±0.0 nM |
---|
Citation | Kozlowski, JA; Yu, W; Wong, MK; Kim, SH; Tong, L; Lavey, BJ; Shankar, BB; Yang, D; Feltz, R; Kosinski, AM; Zhou, G; Rizvi, RK; Dai, C; Fire, L; Girijavallabhan, V; Li, D; Popovici-Muller, J; Richard, JE; Rosner, KE; Siddiqui, MA; Yang, L Compounds for the treatment of inflammatory disorders US Patent US8541572 Publication Date 9/24/2013 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tumor necrosis factor |
---|
Name: | Tumor necrosis factor |
Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
Type: | Enzyme |
Mol. Mass.: | 25645.11 |
Organism: | Homo sapiens (Human) |
Description: | P01375 |
Residue: | 233 |
Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
BDBM102736 |
---|
n/a |
---|
Name | BDBM102736 |
Synonyms: | US8541572, 1907 |
Type | Small organic molecule |
Emp. Form. | C27H27FN6O5 |
Mol. Mass. | 534.5389 |
SMILES | COc1ccc2CN(C[C@]3(NC(=O)NC3=O)C#Cc3cncc(NC(=O)C4CCN(C)CC4)c3)C(=O)c2c1F |r| |
Structure |
|