Reaction Details |
| Report a problem with these data |
Target | Secreted chorismate mutase |
---|
Ligand | BDBM108076 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | CM Assay |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 9.570e+4±n/a nM |
---|
Comments | extracted |
---|
Citation | Jeankumar, VU; Alokam, R; Sridevi, JP; Suryadevara, P; Matikonda, SS; Peddi, S; Sahithi, S; Alvala, M; Yogeeswari, P; Sriram, D Discovery and Structure Optimization of a Series of Isatin Derivatives as Mycobacterium tuberculosis Chorismate Mutase Inhibitors. Chem Biol Drug Des83:498-506 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Secreted chorismate mutase |
---|
Name: | Secreted chorismate mutase |
Synonyms: | Chorismate mutase (CM) | Chorismate mutase (MTB CM) | Chorismate mutase-related protein | SCMU_MYCTU |
Type: | Protein |
Mol. Mass.: | 21942.03 |
Organism: | Mycobacterium tuberculosis H37Rv |
Description: | n/a |
Residue: | 199 |
Sequence: | MLTRPREIYLATAVSIGILLSLIAPLGPPLARADGTSQLAELVDAAAERLEVADPVAAFK
WRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNP
ASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSL
YQRALTTATQSYCQALPPA
|
|
|
BDBM108076 |
---|
n/a |
---|
Name | BDBM108076 |
Synonyms: | 5‐(2,3‐dichlorophenyl)‐1H‐indole‐2,3‐dione (Compound 17) |
Type | Small organic molecule |
Emp. Form. | C14H7Cl2NO2 |
Mol. Mass. | 292.117 |
SMILES | Clc1cccc(c1Cl)-c1ccc2NC(=O)C(=O)c2c1 |
Structure |
|