Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasminogen
LigandBDBM108106
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 0.6±0.0 nM
Citation Herold PDaghish MJelakovic SLudwig FReichelt CSchulze ASchweinitz A Trypsin-like serine protease inhibitors, and their preparation and use US Patent  US8598206 Publication Date 12/3/2013
More Info.:Get all data from this article,  Assay Method
 
Plasminogen
Name:Plasminogen
Synonyms:Activation peptide | Angiostatin | Plasmin | Plasmin heavy chain A | Plasmin heavy chain A, short form | Plasmin light chain B
Type:Enzyme
Mol. Mass.:90579.18
Organism:Homo sapiens (Human)
Description:n/a
Residue:810
Sequence:
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM108106
n/a
NameBDBM108106
Synonyms:US8598206, Table 6, 15
TypeSmall organic molecule
Emp. Form.C37H55N7O5S
Mol. Mass.709.941
SMILESCCCC(=O)N1CCC(CC[C@@H](NS(=O)(=O)Cc2ccccc2)C(=O)N[C@@H](CCC2CCNCC2)C(=O)NCc2ccc(cc2)C(N)=N)CC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: