Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain1/2
LigandBDBM16509
Substrate/Competitorn/a
Meas. Tech.µ-Calpain Inhibition Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50>1.00e+5± 0 nM
Commentsextracted
Citation Baek KHKarki RLee ESNa YKwon Y Synthesis and investigation of dihydroxychalcones as calpain and cathepsin inhibitors. Bioorg Chem 51:24-30 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calpain1/2
Name:Calpain1/2
Synonyms:Calpain -type | Calpain-1 (u-Calpain) | Calpain-1 catalytic subunit
Type:Protein
Mol. Mass.:81880.51
Organism:Homo sapiens (Human)
Description:n/a
Residue:714
Sequence:
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16509
n/a
NameBDBM16509
Synonyms:(2S)-1-[(2S,3S)-3-methyl-2-{[(2S,3S)-3-(propylcarbamoyl)oxiran-2-yl]formamido}pentanoyl]pyrrolidine-2-carboxylic acid | CA074 | CHEMBL490920 | N-{[(2S,3S)-3-(propylcarbamoyl)oxiran-2-yl]carbonyl}-L-isoleucyl-L-proline | PrNH-tES-Ile-Pro-OH | epoxysuccinyl derivative CA074
TypeSmall organic molecule
Emp. Form.C18H29N3O6
Mol. Mass.383.4394
SMILES[H][C@@]1(O[C@]1([H])C(=O)N[C@@H]([C@@H](C)CC)C(=O)N1CCC[C@H]1C(O)=O)C(=O)NCCC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: