| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50186442 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Assay |
|---|
| pH | 7.2±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 12000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Al-Abed, Y Modified macrophage migration inhibitory factor inhibitors US Patent US8618147 Publication Date 12/31/2013 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | MIF_MOUSE | Macrophage migration inhibitory factor (MIF) | Mif |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12505.65 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | P34884 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALC
SLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
|
|
|
|---|
| BDBM50186442 |
|---|
| n/a |
|---|
| Name | BDBM50186442 |
|---|
| Synonyms: | CHEMBL208658 | US8618147, 10 | ethyl 2-(3-(4-hydroxyphenyl)-4,5-dihydroisoxazol-5-yl)acetate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H15NO4 |
|---|
| Mol. Mass. | 249.2625 |
|---|
| SMILES | CCOC(=O)CC1CC(=NO1)c1ccc(O)cc1 |c:8| |
|---|
| Structure | 
|
|---|
Search and Browse
