Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM113765
Substrate/Competitorn/a
Meas. Tech.CB1 & 2 Binding Assays
pH7.4±n/a
Temperature303.15±n/a K
Ki 6.8e+2± 1e+2 nM
Commentsextracted
Citation Chicca ACaprioglio DMinassi APetrucci VAppendino GTaglialatela-Scafati OGertsch J Functionalization of -Caryophyllene Generates Novel Polypharmacology in the Endocannabinoid System. ACS Chem Biol 9:1499-507 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM113765
n/a
NameBDBM113765
Synonyms:(E)-N-Allyl-6-((1R,2R)-3,3-dimethyl-2-(3-methylbut-3-enyl)cyclobutyl)hepta-2,6-dienamide (11b)
TypeSmall organic molecule
Emp. Form.C21H33NO
Mol. Mass.315.4928
SMILESCC(=C)CC[C@@H]1[C@@H](CC1(C)C)C(=C)CC\C=C\C(=O)NCC=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: