Reaction Details |
| Report a problem with these data |
Target | Hematopoietic prostaglandin D synthase |
---|
Ligand | BDBM124925 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibiting Action |
---|
pH | 8±n/a |
---|
IC50 | 27±n/a nM |
---|
Comments | extracted |
---|
Citation | Urade, Y; Kitade, M; Shigeno, K; Yamane, K; Tanaka, K Piperazine compound having a PGDS inhibitory effect US Patent US8765750 Publication Date 7/1/2014 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hematopoietic prostaglandin D synthase |
---|
Name: | Hematopoietic prostaglandin D synthase |
Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
Type: | Enzyme |
Mol. Mass.: | 23341.07 |
Organism: | Homo sapiens (Human) |
Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
Residue: | 199 |
Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
BDBM124925 |
---|
n/a |
---|
Name | BDBM124925 |
Synonyms: | US8765750, 10 |
Type | Small organic molecule |
Emp. Form. | C28H37N7O2 |
Mol. Mass. | 503.6391 |
SMILES | CC1C=CC=C1C(=O)N1CCN(CC1)C(=O)NC1CCN(CC1)c1ccc(CCCn2ccnn2)cc1 |c:2,4| |
Structure |
|