Reaction Details |
| Report a problem with these data |
Target | Arachidonate 5-lipoxygenase-activating protein |
---|
Ligand | BDBM125959 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Scintillation Proximity Assay |
---|
pH | 7.5±n/a |
---|
IC50 | 20±n/a nM |
---|
Comments | extracted |
---|
Citation | De Lombaert, S; Liu, W; Lo, HY; Nemoto, PA Benzimidazole inhibitors of leukotriene production US Patent US8772304 Publication Date 7/8/2014 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Arachidonate 5-lipoxygenase-activating protein |
---|
Name: | Arachidonate 5-lipoxygenase-activating protein |
Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
Type: | Enzyme |
Mol. Mass.: | 18159.90 |
Organism: | Homo sapiens (Human) |
Description: | P20292 |
Residue: | 161 |
Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
BDBM125959 |
---|
n/a |
---|
Name | BDBM125959 |
Synonyms: | US8772304, 21 |
Type | Small organic molecule |
Emp. Form. | C22H20FN9 |
Mol. Mass. | 429.4529 |
SMILES | CC(C)(C)n1c(nc2cc(ccc12)-c1cnc(N)nc1)-c1cc(F)cnc1-n1cncn1 |
Structure |
|