| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [489-587,M535I,L552P,A560V,V571F,I573V] |
|---|
| Ligand | BDBM577 |
|---|
| Substrate/Competitor | fluorescence peptide substrate |
|---|
| Meas. Tech. | Fluorometric Activity Assay |
|---|
| pH | 5.5±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| Ki | 2.3±0.6 nM |
|---|
| Comments | Determined with the fluorometric activity assay. |
|---|
| Citation |  Hanlon, MH; Porter, DJ; Furfine, ES; Spaltenstein, A; Carter, HL; Danger, D; Shu, AY; Kaldor, IW; Miller, JF; Samano, VA Inhibition of wild-type and mutant human immunodeficiency virus type 1 proteases by GW0385 and other arylsulfonamides. Biochemistry43:14500-7 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [489-587,M535I,L552P,A560V,V571F,I573V] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [489-587,M535I,L552P,A560V,V571F,I573V] |
|---|
| Synonyms: | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [489-587,M535I,L552P,A560V,V571F,I573V] |
|---|
| Synonyms: | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) Chain A | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) Chain B | POL_HV1H2 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10809.15 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587,M535I,L552P,A560V,V571F,I573V] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPFNVIGRNLLTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [489-587,M535I,L552P,A560V,V571F,I573V] |
|---|
| Synonyms: | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) Chain A | HIV-1 Protease Mutant (M46I,L63P,A71V,V82F,I84V) Chain B | POL_HV1H2 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10809.15 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587,M535I,L552P,A560V,V571F,I573V] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPFNVIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM577 |
|---|
| fluorescence peptide substrate |
|---|
| Name: | fluorescence peptide substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 3467.28 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 30 |
|---|
| Sequence: | 2-aminobenzoyl-Thr-Ile-Nle-Phe(p-NO2)-Gln-Arg-NH2
|
|
|
|---|
Search and Browse
