| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM129353 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Kinase Assay |
|---|
| pH | 8±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | 3±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Lücking, U; Siemeister, G; Lienau, P; Jautelat, R; Schulze, J Sulfone-substituted anilinopyrimidine derivatives as CDK inhibitors, the production thereof, and use as a medicine US Patent US8802686 Publication Date 8/12/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM129353 |
|---|
| n/a |
|---|
| Name | BDBM129353 |
|---|
| Synonyms: | US8802686, 11 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H20F3N3O5S |
|---|
| Mol. Mass. | 435.418 |
|---|
| SMILES | C[C@@H](O)[C@@H](C)Oc1nc(Nc2ccc(cc2)S(=O)(=O)CCO)ncc1C(F)(F)F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
