Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArginase (SmARG)
LigandBDBM130378
Substrate/Competitorn/a
Meas. Tech.ITC
pH8.5±0
Kd 1.3e+3± 2e+2 nM
Citation Hai YEdwards JEVan Zandt MCHoffmann KFChristianson DW Crystal Structure of Schistosoma mansoni Arginase, a Potential Drug Target for the Treatment of Schistosomiasis Biochemistry 53:4671-4684 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arginase (SmARG)
Name:Arginase (SmARG)
Synonyms:n/a
Type:Protein
Mol. Mass.:39912.83
Organism:Schistosoma mansoni (flatworms)
Description:Q6WVP6
Residue:364
Sequence:
MLKSVATPYYPIQDEKPKLLYTSANFLGIPTNRGQPKIGTYQGPELIRKSNFFQLVAEDG
IQLTDCGDIIPVELNEAEDPQRFGMKWSRSFSLTTLRIAERVEELMKQSNKHTVELSGSK
STPLVIVGGDHSMATGTILGHAEAKPDLCVLWIDAHGDINTPLNSASGNMHGMPLSFLVK
ELQDQIPWLDDFEGIKPCLNASNIAYIGLRDLDAHETHDIRKHGIAYFTMLDVDRMGIEA
VIKEALLAVNPRLEKAIHLSFDIDALDPLVAPSTGTAVPGGLTLREGLRICEEVSATGKL
SVVELAELNPLLGSQEDVLKTQSSAVHILRACLGHCRSGHLPFKVRNLTDQGIMSRAAHM
QTKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM130378
n/a
NameBDBM130378
Synonyms:2(S)-amino-6-boronohexanoic acid (ABH)
TypeSmall organic molecule
Emp. Form.C6H14BNO4
Mol. Mass.174.991
SMILESN[C@@H](CCCCB(O)O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: