| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 1 |
|---|
| Ligand | BDBM50358213 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Kinase Assay |
|---|
| pH | 7.4±n/a |
|---|
| IC50 | 20000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Fischer, PM; Jarman, M; McDonald, E; Nutley, B; Raynaud, F; Wilson, S; Workman, P Purine derivatives US Patent US8846696 Publication Date 9/30/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 1 |
|---|
| Name: | Mitogen-activated protein kinase 1 |
|---|
| Synonyms: | ERK2 | ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK-2) | Extracellular signal-regulated kinase 2 (ERK2) | MAP Kinase 2/ERK2 | MAPK 2 | MAPK1 | MK01_HUMAN | Mitogen activated kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK2) | Mitogen-activated protein kinase 2 | PRKM1 | PRKM2 | p42-MAPK |
|---|
| Type: | Ser/Thr Protein Kinase |
|---|
| Mol. Mass.: | 41392.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P28482 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
|
|
|---|
| BDBM50358213 |
|---|
| n/a |
|---|
| Name | BDBM50358213 |
|---|
| Synonyms: | CHEMBL1922219 | US8846696, (2R3S)-3-{9-Isopropyl-6-[(pyridin-3-ylmethyl)-amino]-9H-purin-2-ylamino}-pentan-2-ol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H27N7O |
|---|
| Mol. Mass. | 369.464 |
|---|
| SMILES | CC[C@H](Nc1nc(NCc2cccnc2)c2ncn(C(C)C)c2n1)[C@@H](C)O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
