Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase B |
---|
Ligand | BDBM140004 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Enzymatic Assay |
---|
pH | 7.8±n/a |
---|
Temperature | 293.15±n/a K |
---|
IC50 | 760±n/a nM |
---|
Comments | extracted |
---|
Citation | Guichou, J; Colliandre, L; Ahmed-Belkacem, H; Pawlotsky, J Inhibitors of cyclophilins and uses thereof US Patent US8901295 Publication Date 12/2/2014 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase B |
---|
Name: | Peptidyl-prolyl cis-trans isomerase B |
Synonyms: | CYP-S1 | CYPB | Cyclophilin B | Cyclophilin B (CypB) | PPIB | PPIB_HUMAN | PPIase | Peptidyl-prolyl cis-trans isomerase B | Rotamase | S-cyclophilin | SCYLP |
Type: | Protein |
Mol. Mass.: | 23751.82 |
Organism: | Homo sapiens (Human) |
Description: | P23284 |
Residue: | 216 |
Sequence: | MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRV
IFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE
|
|
|
BDBM140004 |
---|
n/a |
---|
Name | BDBM140004 |
Synonyms: | US8901295, F680 |
Type | Small organic molecule |
Emp. Form. | C20H23BrN4O2 |
Mol. Mass. | 431.326 |
SMILES | Nc1ccc(CNC(=O)NCC(=O)N2CCCC2c2ccccc2Br)cc1 |
Structure |
|