Reaction Details |
| Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM145201 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Time Resolved-Fluorescence Resonance Energy Transfer (TR-FRET) Assay |
---|
Temperature | 298.15±n/a K |
---|
Ki | <0.01±n/a nM |
---|
Comments | extracted |
---|
Citation | Ding, H; Doherty, GA; Elmore, SW; Hexamer, L; Kunzer, AR; Park, C; Song, X; Souers, AJ; Sullivan, GM; Tao, Z; Wang, L; Wendt, MD; Czabotar, PE; Lessene, GL; Colman, PM Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases US Patent US8952157 Publication Date 2/10/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
Type: | Homodimer or heterodimer |
Mol. Mass.: | 26269.11 |
Organism: | Homo sapiens (Human) |
Description: | P10415 |
Residue: | 239 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM145201 |
---|
n/a |
---|
Name | BDBM145201 |
Synonyms: | US8952157, 392 | US9303025, 392 |
Type | Small organic molecule |
Emp. Form. | C48H58Cl2N8O7S |
Mol. Mass. | 961.995 |
SMILES | CC(C)N1CCC2(CC1)CCC(=C(CN1CCN(CC1)c1ccc(C(=O)NS(=O)(=O)c3ccc(NCC4CCOCC4)c(c3)[N+]([O-])=O)c(Oc3cnc(N)c(Cl)c3)c1)C2)c1ccc(Cl)cc1 |t:12| |
Structure |
|