| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, intestinal |
|---|
| Ligand | BDBM13066 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorophore Displacement Assay |
|---|
| Temperature | 566.3±0 K |
|---|
| Ki | 8.63e+4± 5e+1 nM |
|---|
| Citation |  Patil, R; Laguerre, A; Wielens, J; Headey, SJ; Williams, ML; Hughes, ML; Mohanty, B; Porter, CJ; Scanlon, MJ Characterization of two distinct modes of drug binding to human intestinal fatty acid binding protein. ACS Chem Biol9:2526-34 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, intestinal |
|---|
| Name: | Fatty acid-binding protein, intestinal |
|---|
| Synonyms: | FABP2 | FABPI | FABPI_HUMAN | Fatty acid binding protein intestinal | Fatty acid-binding protein, intestinal | I-FABP | Intestinal fatty acid-binding protein (hIFABP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 15207.56 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 132 |
|---|
| Sequence: | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
|
|
|
|---|
| BDBM13066 |
|---|
| n/a |
|---|
| Name | BDBM13066 |
|---|
| Synonyms: | 2-{2-[(2,6-dichlorophenyl)amino]phenyl}acetic acid | CHEMBL139 | Diclofenac | US11337935, Compound Diclofenac | US11478464, Compound Diclofenac | US11786535, Compound Diclofenac | {2-[(2,6-dichlorophenyl)amino]phenyl}acetic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11Cl2NO2 |
|---|
| Mol. Mass. | 296.149 |
|---|
| SMILES | OC(=O)Cc1ccccc1Nc1c(Cl)cccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
