Reaction Details |
| Report a problem with these data |
Target | Decaprenyl diphosphate synthase |
---|
Ligand | BDBM153307 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | DPPS Inhibition (GPP based) Assay |
---|
pH | 7.5±n/a |
---|
IC50 | 133±n/a nM |
---|
Comments | extracted |
---|
Citation | Kim, MO; Feng, X; Feixas, F; Zhu, W; Lindert, S; Bogue, S; Sinko, W; de Oliveira, C; Rao, G; Oldfield, E; McCammon, JA A Molecular Dynamics Investigation of Mycobacterium tuberculosis Prenyl Synthases: Conformational Flexibility and Implications for Computer-aided Drug Discovery. Chem Biol Drug Des85:756-69 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Decaprenyl diphosphate synthase |
---|
Name: | Decaprenyl diphosphate synthase |
Synonyms: | DPDS_MYCTO | cis-Decaprenyl diphosphate synthase (cis-DPPS) | uppS |
Type: | Protein |
Mol. Mass.: | 33800.02 |
Organism: | Mycobacterium tuberculosis H37Rv |
Description: | n/a |
Residue: | 296 |
Sequence: | MARDARKRTSSNFPQLPPAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRPPQHTSKAAAP
RIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAF
STENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEM
TKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVD
LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
|
|
|
BDBM153307 |
---|
n/a |
---|
Name | BDBM153307 |
Synonyms: | BPH-1167 |
Type | Small organic molecule |
Emp. Form. | C21H25NO4 |
Mol. Mass. | 355.4275 |
SMILES | CCCCCCCOc1cccc(c1)C(=O)Nc1ccccc1C(O)=O |
Structure |
|