| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet-activating factor acetylhydrolase IB subunit alpha2 |
|---|
| Ligand | BDBM154533 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Competitive ABPP Assays in Proteomes with FP-alkyne |
|---|
| pH | 7.5±n/a |
|---|
| IC50 | 8.2e+3±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Chang, JW; Zuhl, AM; Speers, AE; Niessen, S; Brown, SJ; Mulvihill, MM; Fan, YC; Spicer, TP; Southern, M; Scampavia, L; Fernandez-Vega, V; Dix, MM; Cameron, MD; Hodder, PS; Rosen, H; Nomura, DK; Kwon, O; Hsu, KL; Cravatt, BF Selective inhibitor of platelet-activating factor acetylhydrolases 1b2 and 1b3 that impairs cancer cell survival. ACS Chem Biol10:925-32 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Platelet-activating factor acetylhydrolase IB subunit alpha2 |
|---|
| Name: | Platelet-activating factor acetylhydrolase IB subunit alpha2 |
|---|
| Synonyms: | PA1B2_MOUSE | Pafah1b2 | Pafahb | Platelet-activating factor acetylhydrolase 1b2 (PAFAH1b2) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25577.50 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 229 |
|---|
| Sequence: | MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWR
ELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEA
IVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDIDGGFV
HSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
|
|
|
|---|
| BDBM154533 |
|---|
| n/a |
|---|
| Name | BDBM154533 |
|---|
| Synonyms: | 2-(3-chlorophenyl)-1-(4-methylbenzenesulfonyl)-6-(4-methylphenyl)-1,2,5,6-tetrahydropyridine-3-carboxylic acid (J13) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H24ClNO4S |
|---|
| Mol. Mass. | 481.991 |
|---|
| SMILES | Cc1ccc(cc1)C1CC=C(C(N1S(=O)(=O)c1ccc(C)cc1)c1cccc(Cl)c1)C(O)=O |c:10| |
|---|
| Structure | 
|
|---|
Search and Browse
