| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM60412 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarisation Assay |
|---|
| pH | 7.4±n/a |
|---|
| IC50 | 2±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Le Tiran, A; Le Diguarher, T; Starck, J; Henlin, J; Guillouzic, A; De Nanteuil, G; Geneste, O; Fejes, I; Tatai, J; Nyerges, M; Davidson, JE; Murray, JB; Chen, I; Durand, D Pyrrole compounds, a process for their preparation and pharmaceutical compositions containing them US Patent US9108983 Publication Date 8/18/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM60412 |
|---|
| n/a |
|---|
| Name | BDBM60412 |
|---|
| Synonyms: | US9108983, 445 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C42H43ClN6O4 |
|---|
| Mol. Mass. | 731.282 |
|---|
| SMILES | CN1C=CC2N=CC(=CC12)N(C(=O)c1cc(-c2cc(Cl)ccc2C(=O)N2Cc3ccccc3C[C@H]2CN2CCOCC2)n(C)c1C)c1ccc(O)cc1 |c:2,5,7| |
|---|
| Structure | 
|
|---|
Search and Browse
